Dync1li2 (NM_001013380) Mouse Tagged ORF Clone

CAT#: MG207876

  • TrueORF®

Dync1li2 (GFP-tagged) - Mouse dynein, cytoplasmic 1 light intermediate chain 2 (Dync1li2)

 Cited in 1 publication.

  View "NM_001013380" in other vectors (10)

USD 710.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Dync1li2 (NM_001013380) Mouse Tagged ORF Clone
Symbol Dync1li2
Synonyms AA409702; C920003I06; Dncli2; Dnclic2; LIC2
Vector pCMV6-AC-GFP
Sequence Data
>MG207876 representing NM_001013380
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCGGTGGGGGTGGAGAAGAAGCTGCTGCTGGGTCCCAACGGGCCCGCAGTGGCGGCCGCCGGCG
ACCTGACAAGTGAAGAGGAGGAAGGCCAGAGTCTATGGTCTTCGATCTTGAGCGAAGTGTCCACCCGTGC
CAGGTCCAAGCTGCCGTCCGGCAAAAACATTCTGGTGTTCGGTGAAGATGGTTCTGGTAAGACAACTCTC
ATGACCAAACTCCAAGGAGCAGAACACGGCAAAAAAGGAAGAGGCTTAGAGTATCTTTACCTCAGCGTTC
ATGATGAGGACCGGGACGATCACACACGCTGCAATGTGTGGATTTTAGATGGAGACCTCTACCATAAAGG
CCTGCTGAAATTTGCAGTTTCAGCTGAGTCTCTGCGGGAGACCCTGGTCATTTTTGTTGCCGACATGTCT
CGACCTTGGACGATAATGGAGTCTCTGCAGAAGTGGGCTAGTGTTTTACGGGAGCACATTGACAAGATGA
AGATTCCACCGGAGGAGATGCGGGATCTGGAACGGAAATTTATGAAAGAGTTTCAAGATTATATCGAGCC
TGAAGAAGGTTGTCAGGGTTCCCCACAGAGAAGAGGGCCTCTGACCTCAGGCTCAGACGAAGACAGTGTT
GCCCTCCCTCTGGGTGACAACGTGCTGACTCATAACCTGGGGATCCCAGTGTTGGTGGTGTGCACAAAGT
GTGATGCCATGAGCGTCTTGGAGAAGGAGCACGATTACAGGGACGAGCACCTGGACTTCATCCAGGCGCA
CCTGCGGAGATTCTGCCTCCAGTATGGAGCAGCCTTGATTTACACCTCAGTGAAGGAAGAGAAAAACCTT
GACTTGCTGTATAAGTACATTGTTCATAAAACCTATGGCTTCCACTTTACCATACCCGCCTTAGTTGTGG
AAAAGGACGCGGTTTTTATACCTGCAGGCTGGGACAATGAAAAGAAAATAGCTATTTTACATGAAAATTT
TACAACCGTGAAGCCAGAAGACGCGTATGAAGATTTTATTGTAAAGCCGCCTGTGAGAAAGCTGGTCCAT
GACAAAAAGTTGGCAGCGGAGGATGAGCAGGTGTTCCTAATGAAGCAACAGTCACTCCTTGCCAAGCAGC
CTGCCACGCCCACAAGAACCTCCGAATCCCCTGCCAGAGGACCCTCTGGCTCTCCAAGGACGCAGGGTCG
GGGTGGACCAGCTAGTGTACCAAGTGCCTCCCCCGGAACTTCAGTAAAGAAGCCAGATCCAAACATCAAA
AATAATGCGGCAAGTGAAGGGGTATTGGCCAGCTTCTTCAATAGTCTGTTGAGTAAAAAAACAGGCTCTC
CCGGAAGTCCTAGTGCTGGTGGAGTGCAGAGCACAGCCAAGAAGTCAGGACAAAAGACTGTGTTGTCAAA
TGTTCAGGAAGAACTGGATAGAATGACTCGAAAGCCAGACTCCATGGTAACAAACTCTTCAACAGAAAAT
GAAGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG207876 representing NM_001013380
Red=Cloning site Green=Tags(s)

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL
MTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLRETLVIFVADMS
RPWTIMESLQKWASVLREHIDKMKIPPEEMRDLERKFMKEFQDYIEPEEGCQGSPQRRGPLTSGSDEDSV
ALPLGDNVLTHNLGIPVLVVCTKCDAMSVLEKEHDYRDEHLDFIQAHLRRFCLQYGAALIYTSVKEEKNL
DLLYKYIVHKTYGFHFTIPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
DKKLAAEDEQVFLMKQQSLLAKQPATPTRTSESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPSAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN
EA

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001013380
ORF Size 1476 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001013380.1, NP_001013398
RefSeq Size 3145
RefSeq ORF 1479
Locus ID 234663
Cytogenetics 8 D3|8 53.04 cM

Citations (1)

Other Versions

Other products for "Dync1li2"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies