Cd38 (NM_007646) Mouse Tagged ORF Clone

CAT#: MG204265

Cd38 (GFP-tagged) - Mouse CD38 antigen (Cd38)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cd38 (NM_007646) Mouse Tagged ORF Clone
Symbol Cd38
Synonyms ADPRC 1; Cd38-rs1; I-19
Vector pCMV6-AC-GFP
Sequence Data
>MG204265 representing NM_007646
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAACTATGAATTTAGCCAGGTGTCTGGGGACAGACCTGGCTGCCGCCTCTCTAGGAAAGCCCAGA
TCGGTCTCGGAGTGGGTCTCCTGGTCCTGATCGCCTTGGTAGTAGGGATCGTGGTCATACTTCTGAGGCC
GCGCTCACTCCTGGTGTGGACTGGAGAGCCTACCACGAAGCACTTTTCTGACATCTTCCTGGGACGCTGC
CTCATCTACACTCAGATCCTCCGGCCGGAGATGAGAGATCAGAACTGCCAGGAGATACTGAGTACATTCA
AAGGAGCATTTGTTTCCAAGAACCCTTGCAACATCACAAGAGAAGACTACGCCCCACTTGTTAAATTGGT
CACTCAAACCATACCATGTAACAAGACTCTCTTTTGGAGCAAATCCAAACACCTGGCCCATCAATATACT
TGGATCCAGGGAAAGATGTTCACCCTGGAGGACACCCTGCTGGGCTACATTGCTGATGATCTCAGGTGGT
GTGGAGACCCTAGTACTTCTGATATGAACTATGTCTCTTGCCCACATTGGAGTGAAAACTGTCCCAACAA
CCCTATTACTGTGTTCTGGAAAGTGATTTCCCAAAAGTTTGCAGAAGATGCCTGTGGTGTGGTCCAAGTG
ATGCTCAATGGGTCCCTCCGTGAGCCATTTTACAAAAACAGCACCTTTGGAAGTGTGGAAGTCTTTAGTT
TGGACCCAAATAAGGTTCATAAACTACAGGCCTGGGTGATGCACGACATCGAAGGAGCTTCCAGTAACGC
ATGTTCAAGCTCCTCCTTAAATGAGCTGAAGATGATTGTGCAGAAAAGGAATATGATATTTGCCTGCGTG
GATAACTACAGGCCTGCCAGGTTTCTTCAGTGTGTGAAGAACCCTGAGCACCCATCGTGTAGACTTAATA
CG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204265 representing NM_007646
Red=Cloning site Green=Tags(s)

MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTKHFSDIFLGRC
LIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYT
WIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHWSENCPNNPITVFWKVISQKFAEDACGVVQV
MLNGSLREPFYKNSTFGSVEVFSLDPNKVHKLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACV
DNYRPARFLQCVKNPEHPSCRLNT

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007646
ORF Size 912 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007646.2, NP_031672
RefSeq Size 2972
RefSeq ORF 915
Locus ID 12494
Cytogenetics 5 B3|5 23.85 cM
Gene Summary This gene encodes a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Knockout mice deficient for this gene display altered humoral immune responses. In addition, knockout mice exhibit higher locomotor activity and defects in nurturing and social behaviors. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)