Cd38 (NM_007646) Mouse Tagged ORF Clone

CAT#: MG204265

Reviews ()
Write a review
  • TrueORF®

Cd38 (GFP-tagged) - Mouse CD38 antigen (Cd38)



  "NM_007646" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 517.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Cd38
Synonyms ADPRC 1; Cd38-r; Cd38-rs1; I-19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204265 representing NM_007646
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAACTATGAATTTAGCCAGGTGTCTGGGGACAGACCTGGCTGCCGCCTCTCTAGGAAAGCCCAGA
TCGGTCTCGGAGTGGGTCTCCTGGTCCTGATCGCCTTGGTAGTAGGGATCGTGGTCATACTTCTGAGGCC
GCGCTCACTCCTGGTGTGGACTGGAGAGCCTACCACGAAGCACTTTTCTGACATCTTCCTGGGACGCTGC
CTCATCTACACTCAGATCCTCCGGCCGGAGATGAGAGATCAGAACTGCCAGGAGATACTGAGTACATTCA
AAGGAGCATTTGTTTCCAAGAACCCTTGCAACATCACAAGAGAAGACTACGCCCCACTTGTTAAATTGGT
CACTCAAACCATACCATGTAACAAGACTCTCTTTTGGAGCAAATCCAAACACCTGGCCCATCAATATACT
TGGATCCAGGGAAAGATGTTCACCCTGGAGGACACCCTGCTGGGCTACATTGCTGATGATCTCAGGTGGT
GTGGAGACCCTAGTACTTCTGATATGAACTATGTCTCTTGCCCACATTGGAGTGAAAACTGTCCCAACAA
CCCTATTACTGTGTTCTGGAAAGTGATTTCCCAAAAGTTTGCAGAAGATGCCTGTGGTGTGGTCCAAGTG
ATGCTCAATGGGTCCCTCCGTGAGCCATTTTACAAAAACAGCACCTTTGGAAGTGTGGAAGTCTTTAGTT
TGGACCCAAATAAGGTTCATAAACTACAGGCCTGGGTGATGCACGACATCGAAGGAGCTTCCAGTAACGC
ATGTTCAAGCTCCTCCTTAAATGAGCTGAAGATGATTGTGCAGAAAAGGAATATGATATTTGCCTGCGTG
GATAACTACAGGCCTGCCAGGTTTCTTCAGTGTGTGAAGAACCCTGAGCACCCATCGTGTAGACTTAATA
CG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204265 representing NM_007646
Red=Cloning site Green=Tags(s)

MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTKHFSDIFLGRC
LIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYT
WIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHWSENCPNNPITVFWKVISQKFAEDACGVVQV
MLNGSLREPFYKNSTFGSVEVFSLDPNKVHKLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACV
DNYRPARFLQCVKNPEHPSCRLNT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007646
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007646.5
RefSeq Size 2972 bp
RefSeq ORF 915 bp
Locus ID 12494
UniProt ID P56528
Cytogenetics 5 23.85 cM
Gene Summary This gene encodes a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Knockout mice deficient for this gene display altered humoral immune responses. In addition, knockout mice exhibit higher locomotor activity and defects in nurturing and social behaviors. [provided by RefSeq, Sep 2015]

Other Versions

Other products for "Cd38"
Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 704.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 385.00


CD38 Antibody - middle region
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.