2900042B11Rik (BC021897) Mouse Tagged ORF Clone

CAT#: MG200180

  • TrueORF®

2900042B11Rik (tGFP-tagged) - Mouse RIKEN cDNA 2900042B11 gene (cDNA clone MGC:28078 IMAGE:3710627)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "BC021897" in other vectors (4)

Reconstitution Protocol

USD 350.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "2900042B11Rik"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol 2900042B11Rik
Synonyms 2900042B11Rik; IFT25
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200180 representing BC021897
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAAAGTGGATCTCTGCTCAGTCACTGAAGGGACAGAAGTGATTCTGGCCACATCGAGTGATGAAA
AGCACCCACCTGAAAACATCATTGATGGTCCTGCTTGGCGAGGACGTAGAGGGAAGTCGTATTCTCAGAC
CTTTCATTCCAAGAAGAGTGGCCAATGGAGAACACACCACTTTTGTTTATTTCTAATTTTTATTTTATAT
GTGGGTTTTGCCTACATGTATGGCTGTGCGGATATGTTCAGTACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200180 representing BC021897
Red=Cloning site Green=Tags(s)

MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGPAWRGRRGKSYSQTFHSKKSGQWRTHHFCLFLIFILY
VGFAYMYGCADMFST

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC021897
ORF Size 257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC021897, AAH21897
RefSeq Size 1537 bp
RefSeq ORF 257 bp
Locus ID 72938
Cytogenetics 4 C7
Gene Summary Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly (PubMed:22595669). Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation (PubMed:28430876). Plays a role in the early development of the kidney (PubMed:29626631). May be involved in the regulation of ureteric bud initiation (PubMed:29626631).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.