Rps27l (NM_026467) Mouse Tagged ORF Clone

CAT#: MG200171

  • TrueORF®

Rps27l (GFP-tagged) - Mouse ribosomal protein S27-like (Rps27l)

  View "NM_026467" in other vectors (6)

USD 460.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Rps27l (NM_026467) Mouse Tagged ORF Clone
Symbol Rps27l
Synonyms 1810034D23Rik
Vector pCMV6-AC-GFP
Sequence Data
>MG200171 representing NM_026467
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCTGGCTAGAGATCTGTTACACCCTTCCTTGGAGGAGGAGAAGAAAAAACATAAGAAGAAACGGC
TGGTTCAGAGCCCAAATTCTTACTTCATGGATGTGAAATGTCCAGGTTGCTACAAGATTACTACAGTTTT
CAGCCATGCACAGACTGTGGTTCTTTGTGTGGGTTGTTCAACTGTGTTGTGCCAGCCCACAGGAGGAAAA
GCCAGGCTCACAGAAGGCTGTTCATTTAGAAGAAAGCAACAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200171 representing NM_026467
Red=Cloning site Green=Tags(s)

MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK
ARLTEGCSFRRKQH

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_026467
ORF Size 252 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_026467.1, NP_080743
RefSeq Size 467
RefSeq ORF 255
Locus ID 67941
Cytogenetics 9|9 C

Other Versions

Other products for "Rps27l"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones