TUB Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human tubby homolog (mouse) (TUB), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of tubby homolog (mouse) (TUB), transcript variant 2
USD 665.00
Other products for "TUB"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TUB antibody: synthetic peptide directed towards the N terminal of human TUB. Synthetic peptide located within the following region: MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 62 kDa |
Gene Name | tubby bipartite transcription factor |
Database Link | |
Background | TUB functions in signal transduction from heterotrimeric G protein-coupled receptors. It could be involved in the hypothalamic regulation of body weight.This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Synonyms | rd5; RDOB |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 92%; Rabbit: 91%; Dog: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.