TRNT1 Rabbit Polyclonal Antibody

CAT#: TA343834

Rabbit Polyclonal Anti-TRNT1 Antibody

Product Images

WB Suggested Anti-TRNT1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

• 

  Rabbit Anti-TRNT1 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: tRNA nucleotidyl transferase 1
• Database Link:
  NP_057084
  Entrez Gene 51095 Human
  UniProt ID Q96Q11
• Background: TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
• Synonyms: 1; CCA-adding; CCA1; CGI-47; mitochondrial CCA-adding tRNA-nucleotidyltransferase; MtCCA; tRNA nucleotidyl transferase
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Rabbit: 86%