ZNF131 Rabbit Polyclonal Antibody

CAT#: TA342427

Rabbit Polyclonal Anti-ZNF131 Antibody

Product Images

Host: Rabbit; Target Name: ZNF131; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml.ZNF131 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: ZNF131; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.ZNF131 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  WB Suggested Anti-ZNF131 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.ZNF131 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF131 antibody: synthetic peptide directed towards the N terminal of human ZNF131. Synthetic peptide located within the following region: EFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: zinc finger protein 131
• Database Link:
  NP_003423
  Entrez Gene 7690 Human
  UniProt ID P52739
• Background: ZNF131 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 6 C2H2-type zinc fingers. It may be involved in transcriptional regulation. ZNF131 plays a role during development and organogenesis as well as in the function of the adult central nervous system.
• Synonyms: pHZ-10; ZBTB35
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%

Reference Data

• Protein Families: Transcription Factors