Annexin VI (ANXA6) Rabbit Polyclonal Antibody

CAT#: TA341652

Rabbit Polyclonal Anti-ANXA6 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human annexin A6 (ANXA6), transcript variant 2, 20 µg
    • 20 ug

USD 867.00

Other products for "Annexin VI"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ANXA6 antibody: synthetic peptide directed towards the N terminal of human ANXA6. Synthetic peptide located within the following region: ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 74 kDa
Gene Name annexin A6
Background Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members ofThe annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways.The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediatingThe endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
Synonyms ANX6; CBP68
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Zebrafish: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 85%; Mouse: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.