TBL3 Rabbit Polyclonal Antibody

CAT#: TA340113

Rabbit Polyclonal Anti-TBL3 Antibody

Product Images

WB Suggested Anti-TBL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: ACHN cell lysateTBL3 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBL3 antibody: synthetic peptide directed towards the N terminal of human TBL3. Synthetic peptide located within the following region: MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: transducin beta like 3
• Database Link:
  NP_006444
  Entrez Gene 10607 Human
  UniProt ID Q12788
• Background: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate prot
• Synonyms: SAZD; UTP13
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 91%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome