HELT Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human HES/HEY-like transcription factor (HELT), 20 µg
USD 867.00
Other products for "HELT"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HELT antibody: synthetic peptide directed towards the middle region of human HELT. Synthetic peptide located within the following region: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 36 kDa |
Gene Name | helt bHLH transcription factor |
Database Link | |
Background | HELT belongs to the HEY family. It contains 1 basic helix-loop-helix (bHLH) domain and 1orange domain. HELT is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'. |
Synonyms | bHLHb44; HCM1228; HESL; Mgn |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.