ZNF232 Rabbit Polyclonal Antibody

CAT#: TA339469

Rabbit Polyclonal Anti-ZNF232 Antibody

Product Images

WB Suggested Anti-ZNF232 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateZNF232 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF232 antibody: synthetic peptide directed towards the middle region of human ZNF232. Synthetic peptide located within the following region: PFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 232
• Database Link:
  NP_055334
  Entrez Gene 7775 Human
  UniProt ID Q9UNY5
• Background: May be involved in transcriptional regulation.
• Synonyms: ZSCAN11
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 86%

Reference Data

• Protein Families: Transcription Factors