TMEM109 Rabbit Polyclonal Antibody

CAT#: TA338649

Rabbit Polyclonal Anti-TMEM109 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of transmembrane protein 109 (TMEM109)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human transmembrane protein 109 (TMEM109), 20 µg
    • 20 ug

USD 867.00

Other products for "TMEM109"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM109 antibody: synthetic peptide directed towards the middle region of human TMEM109. Synthetic peptide located within the following region: GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name transmembrane protein 109
Background The function remains unknown.
Synonyms MGC5508
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.