Steroidogenic Factor 1 (NR5A1) Rabbit Polyclonal Antibody

CAT#: TA338171

Rabbit Polyclonal Anti-NR5A1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of nuclear receptor subfamily 5, group A, member 1 (NR5A1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Steroidogenic Factor 1"

Specifications

Product Data
Applications WB
Recommended Dilution IHC, WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name nuclear receptor subfamily 5 group A member 1
Background The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. [provided by RefSeq, Jul 2008]
Synonyms AD4BP; ELP; FTZ1; FTZF1; hSF-1; POF7; SF-1; SF1; SPGF8; SRXY3
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Sheep: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.