Steroidogenic Factor 1 (NR5A1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "Steroidogenic Factor 1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | IHC, WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 52 kDa |
Gene Name | nuclear receptor subfamily 5 group A member 1 |
Database Link | |
Background | The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. [provided by RefSeq, Jul 2008] |
Synonyms | AD4BP; ELP; FTZ1; FTZF1; hSF-1; POF7; SF-1; SF1; SPGF8; SRXY3 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Sheep: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.