NBPF11 Rabbit Polyclonal Antibody

CAT#: TA337465

Reviews ()
Write a review

Rabbit Polyclonal Anti-NBPF11 Antibody

 Product Datasheet for 'TA337465'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-NBPF24 antibody is: synthetic peptide directed towards the C-terminal region of Human NBPF24. Synthetic peptide located within the following region: KAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDSTLIG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 58 kDa
Gene Name neuroblastoma breakpoint family member 11
Background The function of this protein remains unknown.
Synonyms NBPF24
Note Immunogen Sequence Homology: Human: 100%; Dog: 77%; Pig: 77%
Reference Data
Other products for "NBPF11"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones