12 Lipoxygenase (ALOX12) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human arachidonate 12-lipoxygenase (ALOX12), 20 µg
USD 867.00
Other products for "12 Lipoxygenase"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 76 kDa |
Gene Name | arachidonate 12-lipoxygenase, 12S type |
Database Link | |
Background | ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity. |
Synonyms | 12-LOX; 12S-LOX; LOG12 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%; Mouse: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.