12 Lipoxygenase (ALOX12) Rabbit Polyclonal Antibody

CAT#: TA336221

Rabbit Polyclonal Anti-ALOX12 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of arachidonate 12-lipoxygenase (ALOX12)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human arachidonate 12-lipoxygenase (ALOX12), 20 µg
    • 20 ug

USD 867.00

Other products for "12 Lipoxygenase"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 76 kDa
Gene Name arachidonate 12-lipoxygenase, 12S type
Background ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.
Synonyms 12-LOX; 12S-LOX; LOG12
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%; Mouse: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.