TAF7L Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "TAF7L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | TATA-box binding protein associated factor 7 like |
Database Link | |
Background | TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. |
Synonyms | CT40; TAF2Q |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 91%; Mouse: 91%; Bovine: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.