GPR177 (WLS) Rabbit Polyclonal Antibody

CAT#: TA335292

Rabbit Polyclonal Anti-GPR177 Antibody

Product Images

WB Suggested Anti-GPR177 Antibody Titration: 0.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: GPR177; Sample Tissue: Human Fetal Liver; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Conc

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR177 antibody: synthetic peptide directed towards the N terminal of human GPR177. Synthetic peptide located within the following region: ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: wntless Wnt ligand secretion mediator
• Database Link:
  NP_001002292
  Entrez Gene 79971 Human
  UniProt ID Q5T9L3
• Background: The function remains unknown.
• Synonyms: C1orf139; EVI; GPR177; mig-14; MRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane