Citrate transport protein (SLC25A1) Rabbit Polyclonal Antibody

CAT#: TA333930

Rabbit Polyclonal Anti-SLC25A1 Antibody

Product Images

WB Suggested Anti-SLC25A1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A1 Antibody: synthetic peptide directed towards the middle region of human SLC25A1. Synthetic peptide located within the following region: NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: solute carrier family 25 member 1
• Database Link:
  NP_005975
  Entrez Gene 6576 Human
  UniProt ID P53007
• Background: The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane (summarized by Kaplan et al., 1993 [PubMed 8514800]).
• Synonyms: CTP; D2L2AD; SEA; SLC20A3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome