Products

Jump to Filters
View as table Download
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA342689

USD 539.00

5 Days

Rabbit Polyclonal Anti-RASSF5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA362743

USD 539.00

5 Days

RASSF5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RASSF5