NORE1 (RASSF5) Rabbit Polyclonal Antibody

CAT#: TA342689

Rabbit Polyclonal Anti-RASSF5 Antibody

Product Images

Host: Rabbit; Target Name: Rassf5; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: Ras association domain family member 5
• Database Link:
  NP_872604
  Entrez Gene 54354 Mouse
  UniProt ID Q8WWW0
• Background: Rassf5 is a potental tumor suppressor. It seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T-cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. It may be involved in regulation of Ras apoptotic function. The RASSF5-STK4/MST1 complex may mediate HRAS1 and KRAS induced apoptosis.
• Synonyms: Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rat: 92%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer