Germany
Japan
United Kingdom
China
Products
View as table Download
USD 224.00
USD 447.00
In Stock
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
5 Days
USD 509.00
5 Days
USD 509.00
5 Days
RASSF5 mouse monoclonal antibody,clone 1C6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
5 Days
RASSF5 mouse monoclonal antibody,clone 1C6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RASSF5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RASSF5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK |
Active filters
Target Symbol
- NORE1
Applications
- WB
Pathways
- Leukocyte transendothelial migration