Products

Antibodies (2)
Proteins (2)
Jump to Filters
View as table Download
NFAT4 (NFATC3) Rabbit Polyclonal Antibody
TA330164

USD 539.00

5 Days

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
NFAT4 (NFATC3) Rabbit Polyclonal Antibody
TA349413

USD 380.00

In Stock

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NFATC3
NFAT4 (NFATC3) CytoSection
TS400357P5

USD 1,174.00

4 Weeks

Transient overexpression of NFATC3, transcript variant 1, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names NF-AT4c; NFAT4; NFATX
Accession Number NM_173165, NP_775188
NFAT4 (NFATC3) CytoSection
TS412523P5

USD 1,174.00

4 Weeks

Transient overexpression of NFATC3, transcript variant 2, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names NF-AT4c; NFAT4; NFATX
Accession Number NM_004555, NP_004546