Goat Polyclonal Anti-CAV1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. |
Goat Polyclonal Anti-CAV1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAV1 |
Rabbit polyclonal Caveolin-1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caveolin-1. |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
Rabbit anti-HLA-A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-A |
Goat Polyclonal Antibody against Caveolin 1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
Rabbit Polyclonal Caveolin-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminal domain of human caveolin-1 |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Anti-Caveolin 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1 |
HLA-A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HLA-A |