Germany
Japan
United Kingdom
China
Early Endosome Marker Antibodies
View as table Download
RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RAB4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG |
Goat Polyclonal Anti-Rab5a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli. |
Goat Polyclonal Anti-Rab5c Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 118 aa to the C-terminus of mouse Rab5c produced in E. coli. |
Rabbit polyclonal anti-RABEP1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RABEP1. |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Active filters
Availabilities
- In Stock