Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)
Applications | ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)
Applications | ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700035 |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human WNT3 |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Smoothened (SMO) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SMO antibody was raised against synthetic peptide - KLH conjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APC2 rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APC2 antibody was raised against synthetic peptide - KLH conjugated |
USD 229.00
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700141 |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700035 |
BMP2 (+ BMP4) rabbit polyclonal antibody, Purified
Applications | ELISA, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4. |
USD 458.00
2 Weeks
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700035, TA700047 |