Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ZNF297B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF297B antibody: synthetic peptide directed towards the N terminal of human ZNF297B. Synthetic peptide located within the following region: LVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSS |
Rabbit Polyclonal Anti-ZNF297B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF297B Antibody: synthetic peptide directed towards the middle region of human ZNF297B. Synthetic peptide located within the following region: QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSI |
Rabbit Polyclonal Anti-ZBTB43 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB43 antibody: synthetic peptide directed towards the N terminal of human ZBTB43. Synthetic peptide located within the following region: EPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVL |
Zbtb43 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ZBTB43