ZBTB43 Rabbit Polyclonal Antibody

CAT#: TA329405

Reviews ()
Write a review

Rabbit Polyclonal anti-ZNF297B antibody

USD 330.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF297B antibody: synthetic peptide directed towards the N terminal of human ZNF297B. Synthetic peptide located within the following region: LVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name zinc finger and BTB domain containing 43
Background ZNF297B is a candidate transcription factor
Synonyms ZBTB22B; ZNF-X; ZNF297B
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 92%; Guinea pig: 92%
Reference Data
Protein Families Transcription Factors
Other products for "ZBTB43"
Frequently bought together (2)
Transient overexpression lysate of zinc finger and BTB domain containing 43 (ZBTB43), transcript variant 1
    • 100 ug

USD 396.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies