Antibodies

Jump to Filters
View as table Download
Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody
TA306253

USD 570.00

5 Days

Rabbit Polyclonal AES Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AES antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human AES.
Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody
TA306254

USD 570.00

5 Days

Rabbit Polyclonal AES Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen AES antibody was raised against a 16 amino acid peptide from near the amino-terminus of human AES.
Tle5 Rabbit Polyclonal Antibody
TA330248

USD 539.00

5 Days

Rabbit Polyclonal Anti-Aes Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the N-terminal region of Mouse Aes. Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
Tle5 Rabbit Polyclonal Antibody
TA331469

USD 539.00

5 Days

Rabbit polyclonal Anti-Aes Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Aes. Synthetic peptide located within the following region: TPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDD