Tle5 Rabbit Polyclonal Antibody

CAT#: TA330248

Rabbit Polyclonal Anti-Aes Antibody

Product Images

WB Suggested Anti-Aes Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the N-terminal region of Mouse Aes. Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: amino-terminal enhancer of split
• Database Link:
  NP_034477
  Entrez Gene 14797 Mouse
  UniProt ID P63002
• Background: Aes acts as dominant repressor towards other family members. Aes inhibits NF-kappa-B-regulated gene expressionand may be required for the initiation and maintenance of the differentiated state .
• Synonyms: AES-1; AES-2; ESP1; GRG; GRG5; TLE5
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%