Rabbit Polyclonal Anti-TIMELESS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TIMELESS Antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR |
Rabbit Polyclonal Anti-TIMELESS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIMELESS antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRD |
Rabbit Polyclonal Anti-TIMELESS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIMELESS antibody: synthetic peptide directed towards the C terminal of human TIMELESS. Synthetic peptide located within the following region: EEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY |
TIMELESS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 969-1208 of human TIMELESS (NP_003911.2). |
| Modifications | Unmodified |
TIMELESS rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-term domain of human hTIM protein |
Germany
Japan
United Kingdom
China
