Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GABA Transporter 1 (GAT-1) (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)ERNMHQMTDGLDK, corresponding to amino acids residues 194-206 of rat GABA Transporter 1 . 2nd extracellular loop. |
Rabbit Polyclonal Anti-SLC6A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A1 Antibody: synthetic peptide directed towards the middle region of human SLC6A1. Synthetic peptide located within the following region: CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT |
Rabbit Anti-GABA Transporter (GAT) 1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit polyclonal anti-SLC6A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC6A1. |
Rabbit Polyclonal Anti-SLC6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A1 Antibody: synthetic peptide directed towards the middle region of human SLC6A1. Synthetic peptide located within the following region: LIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL |
SLC6A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SLC6A1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC6A1