Antibodies

Jump to Filters
View as table Download
SIK3 Rabbit Polyclonal Antibody
TA370889

USD 380.00

4 Weeks

SIK3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SIK3
SIK3 (C-term) Rabbit Polyclonal Antibody
AP52341PU-N

USD 580.00

2 Weeks

SIK3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human QSK
SIK3 Chicken Polyclonal Antibody
TA319854

USD 570.00

5 Days

Chicken Polyclonal SIK3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIK3 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human SIK3.
SIK3 Rabbit Polyclonal Antibody
TA315243

USD 380.00

4 Weeks

Rabbit polyclonal anti-SIK3 / QSK antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human QSK.
SIK3 Rabbit Polyclonal Antibody
TA335450

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIK3 Antibody: synthetic peptide directed towards the middle region of human SIK3. Synthetic peptide located within the following region: LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD
SIK3 Rabbit Polyclonal Antibody
TA335451

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SIK3. Synthetic peptide located within the following region: SDAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPS