Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
SHARPIN mouse monoclonal antibody,clone OTI2B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SHARPIN mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHARPIN mouse monoclonal antibody,clone OTI2B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHARPIN mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
SHARPIN mouse monoclonal antibody,clone OTI2B1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SHARPIN mouse monoclonal antibody,clone OTI2B1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
SHARPIN mouse monoclonal antibody,clone OTI1D11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
SHARPIN mouse monoclonal antibody,clone OTI1D11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-SHARPIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHARPIN antibody: synthetic peptide directed towards the C terminal of human SHARPIN. Synthetic peptide located within the following region: SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP |
SHARPIN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SHARPIN |
Active filters
Target Symbol
- SHARPIN