Rabbit Polyclonal Anti-Rrp15 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rrp15 Antibody is: synthetic peptide directed towards the middle region of Mouse Rrp15. Synthetic peptide located within the following region: DVVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAK |
Rabbit Polyclonal Anti-RRP15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RRP15 Antibody is: synthetic peptide directed towards the C-terminal region of Human RRP15. Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD |
Germany
Japan
United Kingdom
China