RRP15 Rabbit Polyclonal Antibody

CAT#: TA331932

Rabbit Polyclonal Anti-RRP15 Antibody

Product Images

Host: Rabbit; Target Name: RRP15; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml. RRP15 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RRP15 Antibody is: synthetic peptide directed towards the C-terminal region of Human RRP15. Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: ribosomal RNA processing 15 homolog
• Database Link:
  NP_057136
  Entrez Gene 51018 Human
  UniProt ID Q9Y3B9
• Background: This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit.
• Synonyms: CGI-115; KIAA0507
• Note: Immunogen sequence homology: Human: 100%