Rabbit Polyclonal Anti-RNF182 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the N terminal of human RNF182. Synthetic peptide located within the following region: CLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSP |
Rabbit Polyclonal Anti-RNF182 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY |
Germany
Japan
United Kingdom
China