Antibodies

View as table Download

Mouse Monoclonal RNA polymerase II Antibody (4H8)

Applications ChIP, CyTOF-ready, ELISA, FC, ICC/IF, IP, WB
Reactivities Human, Mouse, Yeast
Conjugation Unconjugated

Rabbit polyclonal POLR2A (Ab-1619) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S).

Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody

Applications Dot, WB
Reactivities Human, Chicken, Drosophila, Yeast
Conjugation Unconjugated
Immunogen A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928]

Phospho-POLR2A-S2 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S2 of human POLR2A
Modifications Phospho S2

POLR2A Rabbit polyclonal Antibody

Applications ChIP, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human POLR2A (NP_000928.1).
Modifications Unmodified

POLR2A rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1580-1630 of Human Rpb1.

POLR2A Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2A

Rpb1 (phospho-S1619) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Rpb1 around the phosphorylation site of Serine 1619.

POL II Antibody

Applications ChIP, ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-POL II antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the n-terminal portion of human POL II conjugated to Keyhole Limpet Hemocyanin (KLH).

Phospho-POLR2A-S5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S5 of human POLR2A
Modifications Phospho S5

Phospho-POLR2A-S7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around of human Phospho-POLR2A-S7.
Modifications Phospho S7

Rabbit Polyclonal Anti-POLR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ

POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant

Applications IF, IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated

Phospho-POLR2A-S2/S5 Rabbit mAb

Applications ChIP, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S2/S5 of human POLR2A.