Germany
Japan
United Kingdom
China
POLDIP2 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Goat Anti-POLDIP2 Antibody
| Applications | WB |
| Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFERPDGSHFDVR, from the internal region (near C terminus) of the protein sequence according to NP_056399.1. |
Rabbit Polyclonal Anti-POLDIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLDIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human POLDIP2. Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH |
Goat Polyclonal Anti-TIM-1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TIM-1 Antibody: Peptide with sequence C-THVTYRKDTRYK, from the internal region of the protein sequence according to NP_036338.2. |
POLDIP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human POLDIP2 |
POLDIP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- POLDIP2