POLDIP2 Rabbit Polyclonal Antibody

CAT#: TA338062

Rabbit Polyclonal Anti-POLDIP2 Antibody

Product Images

WB Suggested Anti-POLDIP2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLDIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human POLDIP2. Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: polymerase (DNA) delta interacting protein 2
• Database Link:
  NP_056399
  Entrez Gene 26073 Human
  UniProt ID Q9Y2S7
• Background: This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. The encoded protein also interacts with proliferating cell nuclear antigen. Some transcripts of this gene overlap in a tail-to-tail orientation with the gene for tumor necrosis factor, alpha-induced protein 1 (TNFAIP1).
• Synonyms: p38; PDIP38; POLD4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%