Antibodies

Jump to Filters
View as table Download
MED14 Rabbit Polyclonal Antibody
TA351851

USD 380.00

In Stock

Rabbit Polyclonal Anti-MED14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MED14
MED14 Rabbit Polyclonal Antibody
TA314885

USD 380.00

4 Weeks

Rabbit polyclonal anti-MED14 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MED14.
MED14 Rabbit Polyclonal Antibody
TA344438

USD 539.00

5 Days

Rabbit Polyclonal Anti-MED14 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED14 antibody: synthetic peptide directed towards the middle region of human MED14. Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
MED14 (Center) Rabbit Polyclonal Antibody
AP52649PU-N

USD 580.00

2 Weeks

MED14 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 585-615 amino acids from the Central region of human MED14