Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAFB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: APQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPE |
Rabbit Polyclonal Anti-MAFB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ |
Rabbit Polyclonal Anti-MAFB Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: RPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMAS |
Rabbit Polyclonal Anti-MAFB Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the middle region of human MAFB. Synthetic peptide located within the following region: YAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK |
MAFB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAFB |
MAFB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 184-323 of human MAFB (NP_005452.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAFB
Isotypes
- IgG