MAFB Rabbit Polyclonal Antibody

CAT#: TA334222

Rabbit Polyclonal Anti-MAFB Antibody

Product Images

WB Suggested Anti-MAFB Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: MAF bZIP transcription factor B
• Database Link:
  NP_005452
  Entrez Gene 9935 Human
  UniProt ID Q9Y5Q3
• Background: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells.The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.
• Synonyms: DURS3; KRML; MCTO
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%; Dog: 85%; Yeast: 82%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors