Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
5 Days
USD 509.00
5 Days
Rabbit Polyclonal Anti-ICT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ICT1 antibody: synthetic peptide directed towards the middle region of human ICT1. Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM |
ICT1 (MRPL58) (30-206) mouse monoclonal antibody, clone AT1E9, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ICT1 (MRPL58) (30-206) mouse monoclonal antibody, clone AT1E9, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal ICT1 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ICT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-179 amino acids from the C-terminal region of human ICT1. |
ICT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-206 of human ICT1 (NP_001536.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ICT1