Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1AN |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1AN |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1AN |
HIF1AN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Antibody against Factor Inhibiting HIF-1
Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A C-terminal region synthetic peptide made to the human FIH protein sequence (between residues 300 and the C-terminus). |
Mouse Monoclonal Factor Inhibiting HIF-1 Antibody (162c)
Applications | ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HIF1AN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1AN |
HIF1AN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit anti-HIF1AN Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HIF1AN |
HIF1AN (C-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
HIF1AN (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human HIF1AN. |
HIF1AN (C-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human HIF1AN. |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: EAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTN |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPV |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP |
Rabbit Polyclonal Anti-HIF1AN Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEV |