Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against HEXIM1
| Applications | IF, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HRQQERAPLSKFGD, from the C Terminus of the protein sequence according to NP_006451.1. |
Rabbit Polyclonal Anti-HEXIM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HEXIM1 |
Rabbit Polyclonal Anti-HEXIM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEXIM1 Antibody: A synthesized peptide derived from human HEXIM1 |
Rabbit anti-HEXIM1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HEXIM1 |
Rabbit Polyclonal Anti-HEXIM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HEXIM1 Antibody: synthetic peptide directed towards the C terminal of human HEXIM1. Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD |
Active filters
Target Symbol
- HEXIM1