Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
HAND1 mouse monoclonal antibody, clone 8E7A11, Ascites
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HAND1 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HAND1. |
Rabbit Polyclonal Anti-HAND1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAND1 antibody: synthetic peptide directed towards the N terminal of human HAND1. Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR |
HAND1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-215 of human HAND1 (NP_004812.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HAND1