Antibodies

View as table Download

DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3.

Rabbit Polyclonal DLL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody.

DLL3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLL3

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

USD 580.00

5 Weeks

Anti-DLL3 Reference Antibody (rovalpituzumab)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human
Conjugation Unconjugated

USD 580.00

5 Weeks

Anti-DLL3 Reference Antibody (rovalpituzumab-MMAE)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human, Mouse, Rat, Cynomolgus
Conjugation Unconjugated

USD 580.00

5 Weeks

Anti-DLL3 Reference Antibody (Dragonfly patent anti-DLL3)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human
Conjugation Unconjugated