Antibodies

View as table Download

ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human
Conjugation Unconjugated

ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal ATF3 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Mammalian
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region of human ATF3 (within residues 100-150). [UniProt# P18847]

ATF3 (N159) polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human ATF3.

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal anti-ATF3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATF3.

ATF3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1).
Modifications Unmodified

Rabbit polyclonal anti-ATF3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was produced from a synthetic peptide corresponding to aa 113-130 of human ATF3.

Rabbit Polyclonal Anti-ATF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF3 antibody: synthetic peptide directed towards the middle region of human ATF3. Synthetic peptide located within the following region: PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK

ATF3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 139-168 amino acids from the C-terminal region of human ATF3

Rabbit Polyclonal anti-Atf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI

Rabbit anti-ATF3 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF3

ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human
Conjugation Unconjugated