ARSG mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI4H3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI2D12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI4H3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARSG mouse monoclonal antibody,clone OTI2D12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARSG mouse monoclonal antibody,clone OTI2A8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI2A8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ARSG mouse monoclonal antibody,clone OTI4H3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI4H3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
ARSG mouse monoclonal antibody,clone OTI2D12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ARSG mouse monoclonal antibody,clone OTI2D12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-ARSG Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARSG |
ARSG rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARSG |
Rabbit Polyclonal Anti-Arsg Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Arsg Antibody is: synthetic peptide directed towards the middle region of Rat Arsg. Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN |