Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
Purified ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ARIH2 mouse monoclonal antibody,clone OTI7D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARIH2 mouse monoclonal antibody,clone OTI7D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
Purified ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified ARIH2 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
ARIH2 mouse monoclonal antibody,clone OTI7D5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ARIH2 mouse monoclonal antibody,clone OTI7D5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-ARIH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARIH2 Antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL |
Active filters
Target Symbol
- ARIH2